General Information

  • ID:  hor003389
  • Uniprot ID:  A0A158TFP8
  • Protein name:  Orcomyotropin
  • Gene name:  ORCK
  • Organism:  Cancer borealis (Jonah crab)
  • Family:  Orcokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cancer (genus), Cancridae (family), Cancroidea (superfamily), Heterotremata, Eubrachyura, Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  FDAFTTGFGHS
  • Length:  11
  • Propeptide:  MTRDVICTALLLALCVMASEGAIKDTPTHPANQPDAGYPADGSAAKRFDAFTTGFGHSKRNFDEIDRSGFGFAKRNFDEIDRSGFGFAKRNFDEIDRSGFGFAKRNFDEIDRSGFGFAKRNFDEIDRSSFGFNKRNFDEIDRSSFGFVKRMLTPRDLANLYKRNFDEIDRSGFGFVRRNAE
  • Signal peptide:  MTRDVICTALLLALCVMASEG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Myotropic
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A158TFP8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003389_AF2.pdbhor003389_ESM.pdb

Physical Information

Mass: 136479 Formula: C55H71N13O17
Absent amino acids: CEIKLMNPQRVWY Common amino acids: F
pI: 5.29 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 4
Hydrophobicity: 4.55 Boman Index: -929
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 9.09
Instability Index: 1259.09 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16214114
  • Title:  Identification of Neuropeptides From the Decapod Crustacean Sinus Glands Using Nanoscale Liquid Chromatography Tandem Mass Spectrometry